Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA041399-25

• 

Product Description

Protein Description: NIMA-related kinase 5
Gene Name: NEK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037738: 49%, ENSRNOG00000048769: 49%
Entrez Gene ID: 341676
Uniprot ID: Q6P3R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
• Gene Sequence: FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
• Gene ID - Mouse: ENSMUSG00000037738
• Gene ID - Rat: ENSRNOG00000048769
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) – 1 Found

de Castro Ferezin, Camila; Lim Kam Sian, Terry C C; Wu, Yunjian; Ma, Xiuquan; Chüeh, Anderly C; Huang, Cheng; Schittenhelm, Ralf B; Kobarg, Jörg; Daly, Roger J. Identification of biological pathways and processes regulated by NEK5 in breast epithelial cells via an integrated proteomic approach. Cell Communication And Signaling : Ccs. 2022;20(1):197.