Description
Product Description
Protein Description: NIMA related kinase 4
Gene Name: NEK4
Alternative Gene Name: NRK2, pp12301, STK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021918: 72%, ENSRNOG00000017997: 69%
Entrez Gene ID: 6787
Uniprot ID: P51957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEK4
Alternative Gene Name: NRK2, pp12301, STK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021918: 72%, ENSRNOG00000017997: 69%
Entrez Gene ID: 6787
Uniprot ID: P51957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG |
Gene Sequence | YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG |
Gene ID - Mouse | ENSMUSG00000021918 |
Gene ID - Rat | ENSRNOG00000017997 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NEK4 pAb (ATL-HPA058543) | |
Datasheet | Anti NEK4 pAb (ATL-HPA058543) Datasheet (External Link) |
Vendor Page | Anti NEK4 pAb (ATL-HPA058543) at Atlas Antibodies |
Documents & Links for Anti NEK4 pAb (ATL-HPA058543) | |
Datasheet | Anti NEK4 pAb (ATL-HPA058543) Datasheet (External Link) |
Vendor Page | Anti NEK4 pAb (ATL-HPA058543) |