Anti NEK4 pAb (ATL-HPA058543)

Atlas Antibodies

Catalog No: ATL-HPA058543-25

• 

Product Description

Protein Description: NIMA related kinase 4
Gene Name: NEK4
Alternative Gene Name: NRK2, pp12301, STK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021918: 72%, ENSRNOG00000017997: 69%
Entrez Gene ID: 6787
Uniprot ID: P51957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG
• Gene Sequence: YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG
• Gene ID - Mouse: ENSMUSG00000021918
• Gene ID - Rat: ENSRNOG00000017997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.