Protein Description: NIMA-related kinase 2
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE |
| Documents & Links for Anti NEK2 pAb (ATL-HPA064967) | |
| Datasheet | Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link) |
| Vendor Page | Anti NEK2 pAb (ATL-HPA064967) at Atlas |
| Documents & Links for Anti NEK2 pAb (ATL-HPA064967) | |
| Datasheet | Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link) |
| Vendor Page | Anti NEK2 pAb (ATL-HPA064967) |