Description
Product Description
Protein Description: NIMA-related kinase 2
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEK2
Alternative Gene Name: NEK2A, NLK1, PPP1R111, RP67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110797: 87%, ENSRNOG00000004487: 87%
Entrez Gene ID: 4751
Uniprot ID: P51955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE |
Gene Sequence | FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE |
Gene ID - Mouse | ENSMUSG00000110797 |
Gene ID - Rat | ENSRNOG00000004487 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NEK2 pAb (ATL-HPA064967) | |
Datasheet | Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link) |
Vendor Page | Anti NEK2 pAb (ATL-HPA064967) at Atlas Antibodies |
Documents & Links for Anti NEK2 pAb (ATL-HPA064967) | |
Datasheet | Anti NEK2 pAb (ATL-HPA064967) Datasheet (External Link) |
Vendor Page | Anti NEK2 pAb (ATL-HPA064967) |