Protein Description: nei-like DNA glycosylase 3
Gene Name: NEIL3
Alternative Gene Name: FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039396: 81%, ENSRNOG00000011688: 84%
Entrez Gene ID: 55247
Uniprot ID: Q8TAT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEIL3
Alternative Gene Name: FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039396: 81%, ENSRNOG00000011688: 84%
Entrez Gene ID: 55247
Uniprot ID: Q8TAT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC |
Documents & Links for Anti NEIL3 pAb (ATL-HPA065761) | |
Datasheet | Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link) |
Vendor Page | Anti NEIL3 pAb (ATL-HPA065761) at Atlas |
Documents & Links for Anti NEIL3 pAb (ATL-HPA065761) | |
Datasheet | Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link) |
Vendor Page | Anti NEIL3 pAb (ATL-HPA065761) |