Anti NEIL3 pAb (ATL-HPA065761)

Catalog No:
ATL-HPA065761-25
$447.00

Description

Product Description

Protein Description: nei-like DNA glycosylase 3
Gene Name: NEIL3
Alternative Gene Name: FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039396: 81%, ENSRNOG00000011688: 84%
Entrez Gene ID: 55247
Uniprot ID: Q8TAT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Gene Sequence EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Gene ID - Mouse ENSMUSG00000039396
Gene ID - Rat ENSRNOG00000011688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NEIL3 pAb (ATL-HPA065761)
Datasheet Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link)
Vendor Page Anti NEIL3 pAb (ATL-HPA065761) at Atlas Antibodies

Documents & Links for Anti NEIL3 pAb (ATL-HPA065761)
Datasheet Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link)
Vendor Page Anti NEIL3 pAb (ATL-HPA065761)

Product Description

Protein Description: nei-like DNA glycosylase 3
Gene Name: NEIL3
Alternative Gene Name: FLJ10858, FPG2, hFPG2, hNEI3, ZGRF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039396: 81%, ENSRNOG00000011688: 84%
Entrez Gene ID: 55247
Uniprot ID: Q8TAT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Gene Sequence EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Gene ID - Mouse ENSMUSG00000039396
Gene ID - Rat ENSRNOG00000011688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NEIL3 pAb (ATL-HPA065761)
Datasheet Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link)
Vendor Page Anti NEIL3 pAb (ATL-HPA065761) at Atlas Antibodies

Documents & Links for Anti NEIL3 pAb (ATL-HPA065761)
Datasheet Anti NEIL3 pAb (ATL-HPA065761) Datasheet (External Link)
Vendor Page Anti NEIL3 pAb (ATL-HPA065761)