Protein Description: nei like DNA glycosylase 2
Gene Name: NEIL2
Alternative Gene Name: FLJ31644, MGC2832, MGC4505, NEH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035121: 88%, ENSRNOG00000010696: 89%
Entrez Gene ID: 252969
Uniprot ID: Q969S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEIL2
Alternative Gene Name: FLJ31644, MGC2832, MGC4505, NEH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035121: 88%, ENSRNOG00000010696: 89%
Entrez Gene ID: 252969
Uniprot ID: Q969S2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGN |
Documents & Links for Anti NEIL2 pAb (ATL-HPA073029) | |
Datasheet | Anti NEIL2 pAb (ATL-HPA073029) Datasheet (External Link) |
Vendor Page | Anti NEIL2 pAb (ATL-HPA073029) at Atlas |
Documents & Links for Anti NEIL2 pAb (ATL-HPA073029) | |
Datasheet | Anti NEIL2 pAb (ATL-HPA073029) Datasheet (External Link) |
Vendor Page | Anti NEIL2 pAb (ATL-HPA073029) |