Protein Description: neurofilament, medium polypeptide
Gene Name: NEFM
Alternative Gene Name: NEF3, NF-M, NFM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022054: 98%, ENSRNOG00000013916: 98%
Entrez Gene ID: 4741
Uniprot ID: P07197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEFM
Alternative Gene Name: NEF3, NF-M, NFM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022054: 98%, ENSRNOG00000013916: 98%
Entrez Gene ID: 4741
Uniprot ID: P07197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH |
| Documents & Links for Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) | |
| Datasheet | Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) at Atlas |
| Documents & Links for Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) | |
| Datasheet | Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) |