Protein Description: neurofilament, light polypeptide
Gene Name: NEFL
Alternative Gene Name: CMT1F, CMT2E, NF68, NFL, PPP1R110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022055: 97%, ENSRNOG00000013658: 99%
Entrez Gene ID: 4747
Uniprot ID: P07196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEFL
Alternative Gene Name: CMT1F, CMT2E, NF68, NFL, PPP1R110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022055: 97%, ENSRNOG00000013658: 99%
Entrez Gene ID: 4747
Uniprot ID: P07196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF |
| Documents & Links for Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) | |
| Datasheet | Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) at Atlas |
| Documents & Links for Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) | |
| Datasheet | Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEFL pAb (ATL-HPA014850 w/enhanced validation) |