Protein Description: neurofilament, heavy polypeptide
Gene Name: NEFH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020396: 88%, ENSRNOG00000008716: 94%
Entrez Gene ID: 4744
Uniprot ID: P12036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEFH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020396: 88%, ENSRNOG00000008716: 94%
Entrez Gene ID: 4744
Uniprot ID: P12036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE |
Gene ID - Mouse | ENSMUSG00000020396 |
Gene ID - Rat | ENSMUSG00000020396 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) | |
Datasheet | Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) at Atlas |
Documents & Links for Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) | |
Datasheet | Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NEFH pAb (ATL-HPA061615 w/enhanced validation) |