Protein Description: neural precursor cell expressed, developmentally down-regulated 9
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 72%, ENSRNOG00000014548: 70%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 72%, ENSRNOG00000014548: 70%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA |
Documents & Links for Anti NEDD9 pAb (ATL-HPA072955) | |
Datasheet | Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link) |
Vendor Page | Anti NEDD9 pAb (ATL-HPA072955) at Atlas |
Documents & Links for Anti NEDD9 pAb (ATL-HPA072955) | |
Datasheet | Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link) |
Vendor Page | Anti NEDD9 pAb (ATL-HPA072955) |