Anti NEDD9 pAb (ATL-HPA072955)

Catalog No:
ATL-HPA072955-25
$395.00

Description

Product Description

Protein Description: neural precursor cell expressed, developmentally down-regulated 9
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 72%, ENSRNOG00000014548: 70%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Gene Sequence PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Gene ID - Mouse ENSMUSG00000021365
Gene ID - Rat ENSRNOG00000014548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NEDD9 pAb (ATL-HPA072955)
Datasheet Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA072955) at Atlas Antibodies

Documents & Links for Anti NEDD9 pAb (ATL-HPA072955)
Datasheet Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA072955)

Product Description

Protein Description: neural precursor cell expressed, developmentally down-regulated 9
Gene Name: NEDD9
Alternative Gene Name: CAS-L, CASS2, HEF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021365: 72%, ENSRNOG00000014548: 70%
Entrez Gene ID: 4739
Uniprot ID: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Gene Sequence PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Gene ID - Mouse ENSMUSG00000021365
Gene ID - Rat ENSRNOG00000014548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NEDD9 pAb (ATL-HPA072955)
Datasheet Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA072955) at Atlas Antibodies

Documents & Links for Anti NEDD9 pAb (ATL-HPA072955)
Datasheet Anti NEDD9 pAb (ATL-HPA072955) Datasheet (External Link)
Vendor Page Anti NEDD9 pAb (ATL-HPA072955)