Protein Description: neural precursor cell expressed, developmentally down-regulated 8
Gene Name: NEDD8
Alternative Gene Name: Nedd-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010376: 100%, ENSRNOG00000019895: 100%
Entrez Gene ID: 4738
Uniprot ID: Q15843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NEDD8
Alternative Gene Name: Nedd-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010376: 100%, ENSRNOG00000019895: 100%
Entrez Gene ID: 4738
Uniprot ID: Q15843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
Documents & Links for Anti NEDD8 pAb (ATL-HPA027583) | |
Datasheet | Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link) |
Vendor Page | Anti NEDD8 pAb (ATL-HPA027583) at Atlas |
Documents & Links for Anti NEDD8 pAb (ATL-HPA027583) | |
Datasheet | Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link) |
Vendor Page | Anti NEDD8 pAb (ATL-HPA027583) |