Protein Description: N-terminal EF-hand calcium binding protein 3
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027489: 90%, ENSRNOG00000016708: 88%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027489: 90%, ENSRNOG00000016708: 88%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER |
| Documents & Links for Anti NECAB3 pAb (ATL-HPA071786) | |
| Datasheet | Anti NECAB3 pAb (ATL-HPA071786) Datasheet (External Link) |
| Vendor Page | Anti NECAB3 pAb (ATL-HPA071786) at Atlas |
| Documents & Links for Anti NECAB3 pAb (ATL-HPA071786) | |
| Datasheet | Anti NECAB3 pAb (ATL-HPA071786) Datasheet (External Link) |
| Vendor Page | Anti NECAB3 pAb (ATL-HPA071786) |