Anti NECAB3 pAb (ATL-HPA070595)

Catalog No:
ATL-HPA070595-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: N-terminal EF-hand calcium binding protein 3
Gene Name: NECAB3
Alternative Gene Name: APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027489: 48%, ENSRNOG00000016708: 48%
Entrez Gene ID: 63941
Uniprot ID: Q96P71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAK

Documents & Links for Anti NECAB3 pAb (ATL-HPA070595)
Datasheet Anti NECAB3 pAb (ATL-HPA070595) Datasheet (External Link)
Vendor Page Anti NECAB3 pAb (ATL-HPA070595) at Atlas

Documents & Links for Anti NECAB3 pAb (ATL-HPA070595)
Datasheet Anti NECAB3 pAb (ATL-HPA070595) Datasheet (External Link)
Vendor Page Anti NECAB3 pAb (ATL-HPA070595)