Protein Description: N-terminal EF-hand calcium binding protein 1
Gene Name: NECAB1
Alternative Gene Name: EFCBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040536: 97%, ENSRNOG00000007256: 98%
Entrez Gene ID: 64168
Uniprot ID: Q8N987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NECAB1
Alternative Gene Name: EFCBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040536: 97%, ENSRNOG00000007256: 98%
Entrez Gene ID: 64168
Uniprot ID: Q8N987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH |
Gene Sequence | PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH |
Gene ID - Mouse | ENSMUSG00000040536 |
Gene ID - Rat | ENSRNOG00000007256 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) | |
Datasheet | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) | |
Datasheet | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) |
Citations for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) – 1 Found |
Sjöstedt, Evelina; Fagerberg, Linn; Hallström, Björn M; Häggmark, Anna; Mitsios, Nicholas; Nilsson, Peter; Pontén, Fredrik; Hökfelt, Tomas; Uhlén, Mathias; Mulder, Jan. Defining the Human Brain Proteome Using Transcriptomics and Antibody-Based Profiling with a Focus on the Cerebral Cortex. Plos One. 10(6):e0130028. PubMed |