Protein Description: N-terminal EF-hand calcium binding protein 1
Gene Name: NECAB1
Alternative Gene Name: EFCBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040536: 97%, ENSRNOG00000007256: 98%
Entrez Gene ID: 64168
Uniprot ID: Q8N987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NECAB1
Alternative Gene Name: EFCBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040536: 97%, ENSRNOG00000007256: 98%
Entrez Gene ID: 64168
Uniprot ID: Q8N987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH |
| Documents & Links for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) | |
| Datasheet | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) at Atlas |
| Documents & Links for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) | |
| Datasheet | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) |
| Citations for Anti NECAB1 pAb (ATL-HPA031262 w/enhanced validation) – 1 Found |
| Sjöstedt, Evelina; Fagerberg, Linn; Hallström, Björn M; Häggmark, Anna; Mitsios, Nicholas; Nilsson, Peter; Pontén, Fredrik; Hökfelt, Tomas; Uhlén, Mathias; Mulder, Jan. Defining the Human Brain Proteome Using Transcriptomics and Antibody-Based Profiling with a Focus on the Cerebral Cortex. Plos One. 10(6):e0130028. PubMed |