Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH |
| Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051) | |
| Datasheet | Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link) |
| Vendor Page | Anti NDUFV1 pAb (ATL-HPA075051) at Atlas |
| Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051) | |
| Datasheet | Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link) |
| Vendor Page | Anti NDUFV1 pAb (ATL-HPA075051) |