Description
Product Description
Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH |
Gene ID - Mouse | ENSMUSG00000037916 |
Gene ID - Rat | ENSMUSG00000037916 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051) | |
Datasheet | Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link) |
Vendor Page | Anti NDUFV1 pAb (ATL-HPA075051) at Atlas Antibodies |
Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051) | |
Datasheet | Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link) |
Vendor Page | Anti NDUFV1 pAb (ATL-HPA075051) |