Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation)

Catalog No:
ATL-HPA061953-25
$447.00

Description

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS2
Alternative Gene Name: CI-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013593: 97%, ENSRNOG00000038372: 97%
Entrez Gene ID: 4720
Uniprot ID: O75306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Gene Sequence YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Gene ID - Mouse ENSMUSG00000013593
Gene ID - Rat ENSRNOG00000038372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation)
Datasheet Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation)

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS2
Alternative Gene Name: CI-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013593: 97%, ENSRNOG00000038372: 97%
Entrez Gene ID: 4720
Uniprot ID: O75306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Gene Sequence YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Gene ID - Mouse ENSMUSG00000013593
Gene ID - Rat ENSRNOG00000038372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation)
Datasheet Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation)