Description
Product Description
Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS2
Alternative Gene Name: CI-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013593: 97%, ENSRNOG00000038372: 97%
Entrez Gene ID: 4720
Uniprot ID: O75306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFS2
Alternative Gene Name: CI-49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013593: 97%, ENSRNOG00000038372: 97%
Entrez Gene ID: 4720
Uniprot ID: O75306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP |
Gene Sequence | YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP |
Gene ID - Mouse | ENSMUSG00000013593 |
Gene ID - Rat | ENSRNOG00000038372 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) | |
Datasheet | Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) | |
Datasheet | Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NDUFS2 pAb (ATL-HPA061953 w/enhanced validation) |