Protein Description: NADH:ubiquinone oxidoreductase subunit B4
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000034182: 74%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFB4
Alternative Gene Name: B15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022820: 74%, ENSRNOG00000034182: 74%
Entrez Gene ID: 4710
Uniprot ID: O95168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LKREYLLQYNDPNRRGLIENPALLRWAYART |
Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441) | |
Datasheet | Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link) |
Vendor Page | Anti NDUFB4 pAb (ATL-HPA064441) at Atlas |
Documents & Links for Anti NDUFB4 pAb (ATL-HPA064441) | |
Datasheet | Anti NDUFB4 pAb (ATL-HPA064441) Datasheet (External Link) |
Vendor Page | Anti NDUFB4 pAb (ATL-HPA064441) |