Anti NDUFAB1 pAb (ATL-HPA076020)

Atlas Antibodies

Catalog No: ATL-HPA076020-25

• 
• 

Product Description

Protein Description: NADH:ubiquinone oxidoreductase subunit AB1
Gene Name: NDUFAB1
Alternative Gene Name: ACP, ACP1, FASN2A, SDAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030869: 100%, ENSRNOG00000018129: 97%
Entrez Gene ID: 4706
Uniprot ID: O14561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
• Gene Sequence: IIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
• Gene ID - Mouse: ENSMUSG00000030869
• Gene ID - Rat: ENSRNOG00000018129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.