Protein Description: NADH:ubiquinone oxidoreductase subunit AB1
Gene Name: NDUFAB1
Alternative Gene Name: ACP, ACP1, FASN2A, SDAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030869: 100%, ENSRNOG00000018129: 97%
Entrez Gene ID: 4706
Uniprot ID: O14561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFAB1
Alternative Gene Name: ACP, ACP1, FASN2A, SDAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030869: 100%, ENSRNOG00000018129: 97%
Entrez Gene ID: 4706
Uniprot ID: O14561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE |
Documents & Links for Anti NDUFAB1 pAb (ATL-HPA076020) | |
Datasheet | Anti NDUFAB1 pAb (ATL-HPA076020) Datasheet (External Link) |
Vendor Page | Anti NDUFAB1 pAb (ATL-HPA076020) at Atlas |
Documents & Links for Anti NDUFAB1 pAb (ATL-HPA076020) | |
Datasheet | Anti NDUFAB1 pAb (ATL-HPA076020) Datasheet (External Link) |
Vendor Page | Anti NDUFAB1 pAb (ATL-HPA076020) |