Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Gene Name: NDUFA9
Alternative Gene Name: CI-39k, NDUFS2L, SDR22E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000399: 74%, ENSRNOG00000061684: 70%
Entrez Gene ID: 4704
Uniprot ID: Q16795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFA9
Alternative Gene Name: CI-39k, NDUFS2L, SDR22E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000399: 74%, ENSRNOG00000061684: 70%
Entrez Gene ID: 4704
Uniprot ID: Q16795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL |
| Gene ID - Mouse | ENSMUSG00000000399 |
| Gene ID - Rat | ENSMUSG00000000399 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFA9 pAb (ATL-HPA073212) | |
| Datasheet | Anti NDUFA9 pAb (ATL-HPA073212) Datasheet (External Link) |
| Vendor Page | Anti NDUFA9 pAb (ATL-HPA073212) at Atlas |
| Documents & Links for Anti NDUFA9 pAb (ATL-HPA073212) | |
| Datasheet | Anti NDUFA9 pAb (ATL-HPA073212) Datasheet (External Link) |
| Vendor Page | Anti NDUFA9 pAb (ATL-HPA073212) |