Description
Product Description
Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
Gene Name: NDUFA7
Alternative Gene Name: B14.5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041881: 90%, ENSRNOG00000006939: 88%
Entrez Gene ID: 4701
Uniprot ID: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFA7
Alternative Gene Name: B14.5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041881: 90%, ENSRNOG00000006939: 88%
Entrez Gene ID: 4701
Uniprot ID: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL |
Gene Sequence | SVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL |
Gene ID - Mouse | ENSMUSG00000041881 |
Gene ID - Rat | ENSRNOG00000006939 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) | |
Datasheet | Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) | |
Datasheet | Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NDUFA7 pAb (ATL-HPA071866 w/enhanced validation) |