Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation)

Catalog No:
ATL-HPA059251-25
$447.00

Description

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
Gene Name: NDUFA7
Alternative Gene Name: B14.5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041881: 91%, ENSRNOG00000006939: 91%
Entrez Gene ID: 4701
Uniprot ID: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
Gene Sequence SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
Gene ID - Mouse ENSMUSG00000041881
Gene ID - Rat ENSRNOG00000006939
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation)
Datasheet Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation)

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa
Gene Name: NDUFA7
Alternative Gene Name: B14.5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041881: 91%, ENSRNOG00000006939: 91%
Entrez Gene ID: 4701
Uniprot ID: O95182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
Gene Sequence SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
Gene ID - Mouse ENSMUSG00000041881
Gene ID - Rat ENSRNOG00000006939
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation)
Datasheet Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NDUFA7 pAb (ATL-HPA059251 w/enhanced validation)