Anti NDUFA10 pAb (ATL-HPA059529)

Catalog No:
ATL-HPA059529-100
$596.00

Description

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene ID - Mouse ENSMUSG00000026260
Gene ID - Rat ENSRNOG00000062245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529)
Datasheet Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA059529) at Atlas Antibodies

Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529)
Datasheet Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA059529)

Product Description

Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Gene ID - Mouse ENSMUSG00000026260
Gene ID - Rat ENSRNOG00000062245
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529)
Datasheet Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA059529) at Atlas Antibodies

Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529)
Datasheet Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link)
Vendor Page Anti NDUFA10 pAb (ATL-HPA059529)