Description
Product Description
Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDUFA10
Alternative Gene Name: CI-42k
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026260: 73%, ENSRNOG00000062245: 74%
Entrez Gene ID: 4705
Uniprot ID: O95299
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT |
Gene Sequence | SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT |
Gene ID - Mouse | ENSMUSG00000026260 |
Gene ID - Rat | ENSRNOG00000062245 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529) | |
Datasheet | Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link) |
Vendor Page | Anti NDUFA10 pAb (ATL-HPA059529) at Atlas Antibodies |
Documents & Links for Anti NDUFA10 pAb (ATL-HPA059529) | |
Datasheet | Anti NDUFA10 pAb (ATL-HPA059529) Datasheet (External Link) |
Vendor Page | Anti NDUFA10 pAb (ATL-HPA059529) |