Protein Description: NDC80 kinetochore complex component
Gene Name: NDC80
Alternative Gene Name: HEC, HEC1, hsNDC80, KNTC2, TID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024056: 78%, ENSRNOG00000013727: 76%
Entrez Gene ID: 10403
Uniprot ID: O14777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NDC80
Alternative Gene Name: HEC, HEC1, hsNDC80, KNTC2, TID3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024056: 78%, ENSRNOG00000013727: 76%
Entrez Gene ID: 10403
Uniprot ID: O14777
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ |
| Documents & Links for Anti NDC80 pAb (ATL-HPA066330) | |
| Datasheet | Anti NDC80 pAb (ATL-HPA066330) Datasheet (External Link) |
| Vendor Page | Anti NDC80 pAb (ATL-HPA066330) at Atlas |
| Documents & Links for Anti NDC80 pAb (ATL-HPA066330) | |
| Datasheet | Anti NDC80 pAb (ATL-HPA066330) Datasheet (External Link) |
| Vendor Page | Anti NDC80 pAb (ATL-HPA066330) |