Anti NDC1 pAb (ATL-HPA069751)

Atlas Antibodies

Catalog No: ATL-HPA069751-25

• 

Product Description

Protein Description: NDC1 transmembrane nucleoporin
Gene Name: NDC1
Alternative Gene Name: FLJ10407, NET3, TMEM48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028614: 78%, ENSRNOG00000010620: 69%
Entrez Gene ID: 55706
Uniprot ID: Q9BTX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
• Gene Sequence: VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
• Gene ID - Mouse: ENSMUSG00000028614
• Gene ID - Rat: ENSRNOG00000010620
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.