Protein Description: nuclear receptor coactivator 1
Gene Name: NCOA1
Alternative Gene Name: bHLHe74, F-SRC-1, KAT13A, NCoA-1, RIP160, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020647: 90%, ENSRNOG00000004068: 90%
Entrez Gene ID: 8648
Uniprot ID: Q15788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NCOA1
Alternative Gene Name: bHLHe74, F-SRC-1, KAT13A, NCoA-1, RIP160, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020647: 90%, ENSRNOG00000004068: 90%
Entrez Gene ID: 8648
Uniprot ID: Q15788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NLSLDDVKVKVEKKEQMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAVTSVTIKSEILPAS |
| Documents & Links for Anti NCOA1 pAb (ATL-HPA070213) | |
| Datasheet | Anti NCOA1 pAb (ATL-HPA070213) Datasheet (External Link) |
| Vendor Page | Anti NCOA1 pAb (ATL-HPA070213) at Atlas |
| Documents & Links for Anti NCOA1 pAb (ATL-HPA070213) | |
| Datasheet | Anti NCOA1 pAb (ATL-HPA070213) Datasheet (External Link) |
| Vendor Page | Anti NCOA1 pAb (ATL-HPA070213) |