Protein Description: nucleolin
Gene Name: NCL
Alternative Gene Name: C23, Nsr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026234: 83%, ENSRNOG00000018273: 81%
Entrez Gene ID: 4691
Uniprot ID: P19338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NCL
Alternative Gene Name: C23, Nsr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026234: 83%, ENSRNOG00000018273: 81%
Entrez Gene ID: 4691
Uniprot ID: P19338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYY |
| Documents & Links for Anti NCL pAb (ATL-HPA071110) | |
| Datasheet | Anti NCL pAb (ATL-HPA071110) Datasheet (External Link) |
| Vendor Page | Anti NCL pAb (ATL-HPA071110) at Atlas |
| Documents & Links for Anti NCL pAb (ATL-HPA071110) | |
| Datasheet | Anti NCL pAb (ATL-HPA071110) Datasheet (External Link) |
| Vendor Page | Anti NCL pAb (ATL-HPA071110) |