Anti NCF4 pAb (ATL-HPA057975)

Catalog No:
ATL-HPA057975-25
$395.00

Description

Product Description

Protein Description: neutrophil cytosolic factor 4, 40kDa
Gene Name: NCF4
Alternative Gene Name: p40phox, SH3PXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071715: 88%, ENSRNOG00000006940: 88%
Entrez Gene ID: 4689
Uniprot ID: Q15080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Gene Sequence EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Gene ID - Mouse ENSMUSG00000071715
Gene ID - Rat ENSRNOG00000006940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NCF4 pAb (ATL-HPA057975)
Datasheet Anti NCF4 pAb (ATL-HPA057975) Datasheet (External Link)
Vendor Page Anti NCF4 pAb (ATL-HPA057975) at Atlas Antibodies

Documents & Links for Anti NCF4 pAb (ATL-HPA057975)
Datasheet Anti NCF4 pAb (ATL-HPA057975) Datasheet (External Link)
Vendor Page Anti NCF4 pAb (ATL-HPA057975)

Product Description

Protein Description: neutrophil cytosolic factor 4, 40kDa
Gene Name: NCF4
Alternative Gene Name: p40phox, SH3PXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071715: 88%, ENSRNOG00000006940: 88%
Entrez Gene ID: 4689
Uniprot ID: Q15080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Gene Sequence EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Gene ID - Mouse ENSMUSG00000071715
Gene ID - Rat ENSRNOG00000006940
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NCF4 pAb (ATL-HPA057975)
Datasheet Anti NCF4 pAb (ATL-HPA057975) Datasheet (External Link)
Vendor Page Anti NCF4 pAb (ATL-HPA057975) at Atlas Antibodies

Documents & Links for Anti NCF4 pAb (ATL-HPA057975)
Datasheet Anti NCF4 pAb (ATL-HPA057975) Datasheet (External Link)
Vendor Page Anti NCF4 pAb (ATL-HPA057975)