Protein Description: non-SMC condensin II complex, subunit H2
Gene Name: NCAPH2
Alternative Gene Name: 384D8-2, CAP-H2, hCAP-H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008690: 81%, ENSRNOG00000009598: 82%
Entrez Gene ID: 29781
Uniprot ID: Q6IBW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NCAPH2
Alternative Gene Name: 384D8-2, CAP-H2, hCAP-H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008690: 81%, ENSRNOG00000009598: 82%
Entrez Gene ID: 29781
Uniprot ID: Q6IBW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS |
Documents & Links for Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) | |
Datasheet | Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) at Atlas |
Documents & Links for Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) | |
Datasheet | Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NCAPH2 pAb (ATL-HPA069056 w/enhanced validation) |