Anti NAT9 pAb (ATL-HPA057149)

Atlas Antibodies

Catalog No: ATL-HPA057149-25

• 

Product Description

Protein Description: N-acetyltransferase 9 (GCN5-related, putative)
Gene Name: NAT9
Alternative Gene Name: DKFZP564C103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015542: 70%, ENSRNOG00000003264: 73%
Entrez Gene ID: 26151
Uniprot ID: Q9BTE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP
• Gene Sequence: TLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEP
• Gene ID - Mouse: ENSMUSG00000015542
• Gene ID - Rat: ENSRNOG00000003264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.