Protein Description: N-acetyltransferase 8 (GCN5-related, putative)
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033634: 73%, ENSRNOG00000057086: 69%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033634: 73%, ENSRNOG00000057086: 69%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCV |
| Documents & Links for Anti NAT8 pAb (ATL-HPA074519) | |
| Datasheet | Anti NAT8 pAb (ATL-HPA074519) Datasheet (External Link) |
| Vendor Page | Anti NAT8 pAb (ATL-HPA074519) at Atlas |
| Documents & Links for Anti NAT8 pAb (ATL-HPA074519) | |
| Datasheet | Anti NAT8 pAb (ATL-HPA074519) Datasheet (External Link) |
| Vendor Page | Anti NAT8 pAb (ATL-HPA074519) |