Description
Product Description
Protein Description: N-acetyltransferase 8 (putative)
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030004: 65%, ENSRNOG00000056962: 67%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAT8
Alternative Gene Name: ATase2, GLA, Hcml1, TSC501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030004: 65%, ENSRNOG00000056962: 67%
Entrez Gene ID: 9027
Uniprot ID: Q9UHE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVD |
Gene Sequence | KPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVD |
Gene ID - Mouse | ENSMUSG00000030004 |
Gene ID - Rat | ENSRNOG00000056962 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) | |
Datasheet | Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) | |
Datasheet | Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti NAT8 pAb (ATL-HPA067855 w/enhanced validation) |