Anti NAT10 pAb (ATL-HPA071628)

Atlas Antibodies

Catalog No: ATL-HPA071628-25

• 

Product Description

Protein Description: N-acetyltransferase 10 (GCN5-related)
Gene Name: NAT10
Alternative Gene Name: FLJ10774, FLJ12179, hALP, KIAA1709, NET43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027185: 99%, ENSRNOG00000008663: 99%
Entrez Gene ID: 55226
Uniprot ID: Q9H0A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP
• Gene Sequence: RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP
• Gene ID - Mouse: ENSMUSG00000027185
• Gene ID - Rat: ENSRNOG00000008663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.