Anti NAP1L5 pAb (ATL-HPA058227)

Atlas Antibodies

Catalog No: ATL-HPA058227-25

• 
• 

Product Description

Protein Description: nucleosome assembly protein 1-like 5
Gene Name: NAP1L5
Alternative Gene Name: DRLM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055430: 71%, ENSRNOG00000007808: 71%
Entrez Gene ID: 266812
Uniprot ID: Q96NT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCR
• Gene Sequence: AAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCR
• Gene ID - Mouse: ENSMUSG00000055430
• Gene ID - Rat: ENSRNOG00000007808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.