Anti NANOS3 pAb (ATL-HPA062989)

Catalog No:
ATL-HPA062989-25
$303.00

Description

Product Description

Protein Description: nanos homolog 3 (Drosophila)
Gene Name: NANOS3
Alternative Gene Name: NANOS1L, NOS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%
Entrez Gene ID:
Uniprot ID: P60323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Gene Sequence LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Gene ID - Mouse ENSMUSG00000056155
Gene ID - Rat ENSRNOG00000031593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NANOS3 pAb (ATL-HPA062989)
Datasheet Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link)
Vendor Page Anti NANOS3 pAb (ATL-HPA062989) at Atlas Antibodies

Documents & Links for Anti NANOS3 pAb (ATL-HPA062989)
Datasheet Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link)
Vendor Page Anti NANOS3 pAb (ATL-HPA062989)

Product Description

Protein Description: nanos homolog 3 (Drosophila)
Gene Name: NANOS3
Alternative Gene Name: NANOS1L, NOS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%
Entrez Gene ID:
Uniprot ID: P60323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Gene Sequence LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Gene ID - Mouse ENSMUSG00000056155
Gene ID - Rat ENSRNOG00000031593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NANOS3 pAb (ATL-HPA062989)
Datasheet Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link)
Vendor Page Anti NANOS3 pAb (ATL-HPA062989) at Atlas Antibodies

Documents & Links for Anti NANOS3 pAb (ATL-HPA062989)
Datasheet Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link)
Vendor Page Anti NANOS3 pAb (ATL-HPA062989)