Protein Description: nanos homolog 3 (Drosophila)
Gene Name: NANOS3
Alternative Gene Name: NANOS1L, NOS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%
Entrez Gene ID:
Uniprot ID: P60323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NANOS3
Alternative Gene Name: NANOS1L, NOS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%
Entrez Gene ID:
Uniprot ID: P60323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG |
| Documents & Links for Anti NANOS3 pAb (ATL-HPA062989) | |
| Datasheet | Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link) |
| Vendor Page | Anti NANOS3 pAb (ATL-HPA062989) at Atlas |
| Documents & Links for Anti NANOS3 pAb (ATL-HPA062989) | |
| Datasheet | Anti NANOS3 pAb (ATL-HPA062989) Datasheet (External Link) |
| Vendor Page | Anti NANOS3 pAb (ATL-HPA062989) |