Anti NANOG pAb (ATL-HPA072117)

Atlas Antibodies

Catalog No: ATL-HPA072117-25

• 

Product Description

Protein Description: Nanog homeobox
Gene Name: NANOG
Alternative Gene Name: FLJ12581, FLJ40451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012396: 51%, ENSRNOG00000008368: 62%
Entrez Gene ID: 79923
Uniprot ID: Q9H9S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD
• Gene Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD
• Gene ID - Mouse: ENSMUSG00000012396
• Gene ID - Rat: ENSRNOG00000008368
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.