Description
Product Description
Protein Description: Nanog homeobox
Gene Name: NANOG
Alternative Gene Name: FLJ12581, FLJ40451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012396: 51%, ENSRNOG00000008368: 62%
Entrez Gene ID: 79923
Uniprot ID: Q9H9S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NANOG
Alternative Gene Name: FLJ12581, FLJ40451
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012396: 51%, ENSRNOG00000008368: 62%
Entrez Gene ID: 79923
Uniprot ID: Q9H9S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD |
Gene Sequence | MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPD |
Gene ID - Mouse | ENSMUSG00000012396 |
Gene ID - Rat | ENSRNOG00000008368 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NANOG pAb (ATL-HPA072117) | |
Datasheet | Anti NANOG pAb (ATL-HPA072117) Datasheet (External Link) |
Vendor Page | Anti NANOG pAb (ATL-HPA072117) at Atlas Antibodies |
Documents & Links for Anti NANOG pAb (ATL-HPA072117) | |
Datasheet | Anti NANOG pAb (ATL-HPA072117) Datasheet (External Link) |
Vendor Page | Anti NANOG pAb (ATL-HPA072117) |