Protein Description: nuclear apoptosis inducing factor 1
Gene Name: NAIF1
Alternative Gene Name: bA379C10.2, C9orf90, DKFZp762G199
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039164: 94%, ENSRNOG00000050204: 96%
Entrez Gene ID: 203245
Uniprot ID: Q69YI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAIF1
Alternative Gene Name: bA379C10.2, C9orf90, DKFZp762G199
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039164: 94%, ENSRNOG00000050204: 96%
Entrez Gene ID: 203245
Uniprot ID: Q69YI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ |
Documents & Links for Anti NAIF1 pAb (ATL-HPA064931) | |
Datasheet | Anti NAIF1 pAb (ATL-HPA064931) Datasheet (External Link) |
Vendor Page | Anti NAIF1 pAb (ATL-HPA064931) at Atlas |
Documents & Links for Anti NAIF1 pAb (ATL-HPA064931) | |
Datasheet | Anti NAIF1 pAb (ATL-HPA064931) Datasheet (External Link) |
Vendor Page | Anti NAIF1 pAb (ATL-HPA064931) |