Protein Description: nuclear assembly factor 1 ribonucleoprotein
Gene Name: NAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014907: 69%, ENSRNOG00000026403: 73%
Entrez Gene ID: 92345
Uniprot ID: Q96HR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014907: 69%, ENSRNOG00000026403: 73%
Entrez Gene ID: 92345
Uniprot ID: Q96HR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPF |
| Documents & Links for Anti NAF1 pAb (ATL-HPA066090) | |
| Datasheet | Anti NAF1 pAb (ATL-HPA066090) Datasheet (External Link) |
| Vendor Page | Anti NAF1 pAb (ATL-HPA066090) at Atlas |
| Documents & Links for Anti NAF1 pAb (ATL-HPA066090) | |
| Datasheet | Anti NAF1 pAb (ATL-HPA066090) Datasheet (External Link) |
| Vendor Page | Anti NAF1 pAb (ATL-HPA066090) |