Anti NACC1 pAb (ATL-HPA062245 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062245-100

• 
• 
• 

Product Description

Protein Description: nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
Gene Name: NACC1
Alternative Gene Name: BEND8, BTBD14B, BTBD30, NAC-1, NAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001910: 71%, ENSRNOG00000002864: 73%
Entrez Gene ID: 112939
Uniprot ID: Q96RE7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEAL
• Gene Sequence: RVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEAL
• Gene ID - Mouse: ENSMUSG00000001910
• Gene ID - Rat: ENSRNOG00000002864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.