Description
Product Description
Protein Description: N(alpha)-acetyltransferase 50, NatE catalytic subunit
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF |
Gene Sequence | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF |
Gene ID - Mouse | ENSMUSG00000022698 |
Gene ID - Rat | ENSRNOG00000039017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NAA50 pAb (ATL-HPA074489) | |
Datasheet | Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link) |
Vendor Page | Anti NAA50 pAb (ATL-HPA074489) at Atlas Antibodies |
Documents & Links for Anti NAA50 pAb (ATL-HPA074489) | |
Datasheet | Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link) |
Vendor Page | Anti NAA50 pAb (ATL-HPA074489) |