![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101310/181395/atl-hpa074489_anti-naa50-pab-atl-hpa074489_63063__95139.1681137713.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: N(alpha)-acetyltransferase 50, NatE catalytic subunit
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NAA50
Alternative Gene Name: FLJ13194, MAK3, NAT13, NAT5, San
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022698: 100%, ENSRNOG00000039017: 100%
Entrez Gene ID: 80218
Uniprot ID: Q9GZZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYF |
| Documents & Links for Anti NAA50 pAb (ATL-HPA074489) | |
| Datasheet | Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link) |
| Vendor Page | Anti NAA50 pAb (ATL-HPA074489) at Atlas |
| Documents & Links for Anti NAA50 pAb (ATL-HPA074489) | |
| Datasheet | Anti NAA50 pAb (ATL-HPA074489) Datasheet (External Link) |
| Vendor Page | Anti NAA50 pAb (ATL-HPA074489) |