Anti N4BP2L2 pAb (ATL-HPA059327)

Catalog No:
ATL-HPA059327-25
$447.00

Description

Product Description

Protein Description: NEDD4 binding protein 2-like 2
Gene Name: N4BP2L2
Alternative Gene Name: CG005, PFAAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029655: 44%, ENSRNOG00000001108: 46%
Entrez Gene ID: 10443
Uniprot ID: Q92802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR
Gene Sequence GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR
Gene ID - Mouse ENSMUSG00000029655
Gene ID - Rat ENSRNOG00000001108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327)
Datasheet Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link)
Vendor Page Anti N4BP2L2 pAb (ATL-HPA059327) at Atlas Antibodies

Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327)
Datasheet Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link)
Vendor Page Anti N4BP2L2 pAb (ATL-HPA059327)

Product Description

Protein Description: NEDD4 binding protein 2-like 2
Gene Name: N4BP2L2
Alternative Gene Name: CG005, PFAAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029655: 44%, ENSRNOG00000001108: 46%
Entrez Gene ID: 10443
Uniprot ID: Q92802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR
Gene Sequence GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR
Gene ID - Mouse ENSMUSG00000029655
Gene ID - Rat ENSRNOG00000001108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327)
Datasheet Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link)
Vendor Page Anti N4BP2L2 pAb (ATL-HPA059327) at Atlas Antibodies

Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327)
Datasheet Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link)
Vendor Page Anti N4BP2L2 pAb (ATL-HPA059327)