Description
Product Description
Protein Description: NEDD4 binding protein 2-like 2
Gene Name: N4BP2L2
Alternative Gene Name: CG005, PFAAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029655: 44%, ENSRNOG00000001108: 46%
Entrez Gene ID: 10443
Uniprot ID: Q92802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: N4BP2L2
Alternative Gene Name: CG005, PFAAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029655: 44%, ENSRNOG00000001108: 46%
Entrez Gene ID: 10443
Uniprot ID: Q92802
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR |
Gene Sequence | GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR |
Gene ID - Mouse | ENSMUSG00000029655 |
Gene ID - Rat | ENSRNOG00000001108 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327) | |
Datasheet | Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link) |
Vendor Page | Anti N4BP2L2 pAb (ATL-HPA059327) at Atlas Antibodies |
Documents & Links for Anti N4BP2L2 pAb (ATL-HPA059327) | |
Datasheet | Anti N4BP2L2 pAb (ATL-HPA059327) Datasheet (External Link) |
Vendor Page | Anti N4BP2L2 pAb (ATL-HPA059327) |