Anti N4BP2 pAb (ATL-HPA072549)

Catalog No:
ATL-HPA072549-25
$447.00

Description

Product Description

Protein Description: NEDD4 binding protein 2
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Gene Sequence GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Gene ID - Mouse ENSMUSG00000037795
Gene ID - Rat ENSRNOG00000000279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti N4BP2 pAb (ATL-HPA072549)
Datasheet Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link)
Vendor Page Anti N4BP2 pAb (ATL-HPA072549) at Atlas Antibodies

Documents & Links for Anti N4BP2 pAb (ATL-HPA072549)
Datasheet Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link)
Vendor Page Anti N4BP2 pAb (ATL-HPA072549)

Product Description

Protein Description: NEDD4 binding protein 2
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Gene Sequence GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK
Gene ID - Mouse ENSMUSG00000037795
Gene ID - Rat ENSRNOG00000000279
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti N4BP2 pAb (ATL-HPA072549)
Datasheet Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link)
Vendor Page Anti N4BP2 pAb (ATL-HPA072549) at Atlas Antibodies

Documents & Links for Anti N4BP2 pAb (ATL-HPA072549)
Datasheet Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link)
Vendor Page Anti N4BP2 pAb (ATL-HPA072549)