Protein Description: NEDD4 binding protein 2
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK |
| Documents & Links for Anti N4BP2 pAb (ATL-HPA072549) | |
| Datasheet | Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link) |
| Vendor Page | Anti N4BP2 pAb (ATL-HPA072549) at Atlas |
| Documents & Links for Anti N4BP2 pAb (ATL-HPA072549) | |
| Datasheet | Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link) |
| Vendor Page | Anti N4BP2 pAb (ATL-HPA072549) |