Description
Product Description
Protein Description: NEDD4 binding protein 2
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: N4BP2
Alternative Gene Name: B3BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037795: 91%, ENSRNOG00000000279: 29%
Entrez Gene ID: 55728
Uniprot ID: Q86UW6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK |
Gene Sequence | GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK |
Gene ID - Mouse | ENSMUSG00000037795 |
Gene ID - Rat | ENSRNOG00000000279 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti N4BP2 pAb (ATL-HPA072549) | |
Datasheet | Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link) |
Vendor Page | Anti N4BP2 pAb (ATL-HPA072549) at Atlas Antibodies |
Documents & Links for Anti N4BP2 pAb (ATL-HPA072549) | |
Datasheet | Anti N4BP2 pAb (ATL-HPA072549) Datasheet (External Link) |
Vendor Page | Anti N4BP2 pAb (ATL-HPA072549) |