Description
Product Description
Protein Description: Myb-like, SWIRM and MPN domains 1
Gene Name: MYSM1
Alternative Gene Name: KIAA1915
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062627: 92%, ENSRNOG00000026299: 92%
Entrez Gene ID: 114803
Uniprot ID: Q5VVJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYSM1
Alternative Gene Name: KIAA1915
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062627: 92%, ENSRNOG00000026299: 92%
Entrez Gene ID: 114803
Uniprot ID: Q5VVJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQLAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLS |
Gene Sequence | VNCIGRIHTYLELIGAINFGCEQAVYNRPQTVDKVRIRDRKDAVEAYQLAQRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLS |
Gene ID - Mouse | ENSMUSG00000062627 |
Gene ID - Rat | ENSRNOG00000026299 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYSM1 pAb (ATL-HPA067133) | |
Datasheet | Anti MYSM1 pAb (ATL-HPA067133) Datasheet (External Link) |
Vendor Page | Anti MYSM1 pAb (ATL-HPA067133) at Atlas Antibodies |
Documents & Links for Anti MYSM1 pAb (ATL-HPA067133) | |
Datasheet | Anti MYSM1 pAb (ATL-HPA067133) Datasheet (External Link) |
Vendor Page | Anti MYSM1 pAb (ATL-HPA067133) |