Protein Description: myocardin
Gene Name: MYOCD
Alternative Gene Name: MYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020542: 73%, ENSRNOG00000003669: 75%
Entrez Gene ID: 93649
Uniprot ID: Q8IZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYOCD
Alternative Gene Name: MYCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020542: 73%, ENSRNOG00000003669: 75%
Entrez Gene ID: 93649
Uniprot ID: Q8IZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARNRCNSADLVNMHILQASTAERSIPTAQM |
| Documents & Links for Anti MYOCD pAb (ATL-HPA071528) | |
| Datasheet | Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link) |
| Vendor Page | Anti MYOCD pAb (ATL-HPA071528) at Atlas |
| Documents & Links for Anti MYOCD pAb (ATL-HPA071528) | |
| Datasheet | Anti MYOCD pAb (ATL-HPA071528) Datasheet (External Link) |
| Vendor Page | Anti MYOCD pAb (ATL-HPA071528) |