Description
Product Description
Protein Description: myosin XVI
Gene Name: MYO16
Alternative Gene Name: KIAA0865, Myo16b, MYR8, NYAP3, PPP1R107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039057: 83%, ENSRNOG00000016483: 80%
Entrez Gene ID: 23026
Uniprot ID: Q9Y6X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYO16
Alternative Gene Name: KIAA0865, Myo16b, MYR8, NYAP3, PPP1R107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039057: 83%, ENSRNOG00000016483: 80%
Entrez Gene ID: 23026
Uniprot ID: Q9Y6X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LFQSKLSQTGSLVSAYPSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLM |
Gene Sequence | LFQSKLSQTGSLVSAYPSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLM |
Gene ID - Mouse | ENSMUSG00000039057 |
Gene ID - Rat | ENSRNOG00000016483 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYO16 pAb (ATL-HPA071948) | |
Datasheet | Anti MYO16 pAb (ATL-HPA071948) Datasheet (External Link) |
Vendor Page | Anti MYO16 pAb (ATL-HPA071948) at Atlas Antibodies |
Documents & Links for Anti MYO16 pAb (ATL-HPA071948) | |
Datasheet | Anti MYO16 pAb (ATL-HPA071948) Datasheet (External Link) |
Vendor Page | Anti MYO16 pAb (ATL-HPA071948) |