Anti MYO15A pAb (ATL-HPA078501)

Atlas Antibodies

Catalog No: ATL-HPA078501-25

• 

Product Description

Protein Description: myosin XVA
Gene Name: MYO15A
Alternative Gene Name: DFNB3, MYO15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042678: 86%, ENSRNOG00000059219: 87%
Entrez Gene ID: 51168
Uniprot ID: Q9UKN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA
• Gene Sequence: LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA
• Gene ID - Mouse: ENSMUSG00000042678
• Gene ID - Rat: ENSRNOG00000059219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.