Protein Description: myosin XVA
Gene Name: MYO15A
Alternative Gene Name: DFNB3, MYO15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042678: 86%, ENSRNOG00000059219: 87%
Entrez Gene ID: 51168
Uniprot ID: Q9UKN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYO15A
Alternative Gene Name: DFNB3, MYO15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042678: 86%, ENSRNOG00000059219: 87%
Entrez Gene ID: 51168
Uniprot ID: Q9UKN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA |
| Gene ID - Mouse | ENSMUSG00000042678 |
| Gene ID - Rat | ENSMUSG00000042678 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYO15A pAb (ATL-HPA078501) | |
| Datasheet | Anti MYO15A pAb (ATL-HPA078501) Datasheet (External Link) |
| Vendor Page | Anti MYO15A pAb (ATL-HPA078501) at Atlas |
| Documents & Links for Anti MYO15A pAb (ATL-HPA078501) | |
| Datasheet | Anti MYO15A pAb (ATL-HPA078501) Datasheet (External Link) |
| Vendor Page | Anti MYO15A pAb (ATL-HPA078501) |