Anti MYLK3 pAb (ATL-HPA073447 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA073447-25

• 

Product Description

Protein Description: myosin light chain kinase 3
Gene Name: MYLK3
Alternative Gene Name: caMLCK, MLCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031698: 49%, ENSRNOG00000017546: 45%
Entrez Gene ID: 91807
Uniprot ID: Q32MK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAK
• Gene Sequence: EEEGGKPKHVLSTSGVQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHLPLPTKVEAK
• Gene ID - Mouse: ENSMUSG00000031698
• Gene ID - Rat: ENSRNOG00000017546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.