Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064783-100

• 
• 
• 

Product Description

Protein Description: myosin heavy chain 9
Gene Name: MYH9
Alternative Gene Name: DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022443: 88%, ENSRNOG00000049236: 87%
Entrez Gene ID: 4627
Uniprot ID: P35579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA
• Gene Sequence: LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA
• Gene ID - Mouse: ENSMUSG00000022443
• Gene ID - Rat: ENSRNOG00000049236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.