Description
Product Description
Protein Description: myosin heavy chain 9
Gene Name: MYH9
Alternative Gene Name: DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022443: 88%, ENSRNOG00000049236: 87%
Entrez Gene ID: 4627
Uniprot ID: P35579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYH9
Alternative Gene Name: DFNA17, EPSTS, FTNS, MHA, NMHC-II-A, NMMHCA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022443: 88%, ENSRNOG00000049236: 87%
Entrez Gene ID: 4627
Uniprot ID: P35579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA |
Gene Sequence | LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA |
Gene ID - Mouse | ENSMUSG00000022443 |
Gene ID - Rat | ENSRNOG00000049236 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) | |
Datasheet | Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) | |
Datasheet | Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MYH9 pAb (ATL-HPA064783 w/enhanced validation) |