Description
Product Description
Protein Description: myosin, heavy chain 14, non-muscle
Gene Name: MYH14
Alternative Gene Name: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030739: 94%, ENSRNOG00000020014: 92%
Entrez Gene ID: 79784
Uniprot ID: Q7Z406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYH14
Alternative Gene Name: DFNA4, FLJ13881, KIAA2034, MHC16, MYH17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030739: 94%, ENSRNOG00000020014: 92%
Entrez Gene ID: 79784
Uniprot ID: Q7Z406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE |
Gene Sequence | GAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHEE |
Gene ID - Mouse | ENSMUSG00000030739 |
Gene ID - Rat | ENSRNOG00000020014 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYH14 pAb (ATL-HPA070260) | |
Datasheet | Anti MYH14 pAb (ATL-HPA070260) Datasheet (External Link) |
Vendor Page | Anti MYH14 pAb (ATL-HPA070260) at Atlas Antibodies |
Documents & Links for Anti MYH14 pAb (ATL-HPA070260) | |
Datasheet | Anti MYH14 pAb (ATL-HPA070260) Datasheet (External Link) |
Vendor Page | Anti MYH14 pAb (ATL-HPA070260) |