Protein Description: v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog
Gene Name: MYCL
Alternative Gene Name: bHLHe38, LMYC, MYCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028654: 86%, ENSRNOG00000014259: 86%
Entrez Gene ID: 4610
Uniprot ID: P12524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYCL
Alternative Gene Name: bHLHe38, LMYC, MYCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028654: 86%, ENSRNOG00000014259: 86%
Entrez Gene ID: 4610
Uniprot ID: P12524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS |
| Documents & Links for Anti MYCL pAb (ATL-HPA063132) | |
| Datasheet | Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link) |
| Vendor Page | Anti MYCL pAb (ATL-HPA063132) at Atlas |
| Documents & Links for Anti MYCL pAb (ATL-HPA063132) | |
| Datasheet | Anti MYCL pAb (ATL-HPA063132) Datasheet (External Link) |
| Vendor Page | Anti MYCL pAb (ATL-HPA063132) |