Anti MYCBP2 pAb (ATL-HPA058807)

Atlas Antibodies

Catalog No: ATL-HPA058807-25

• 

Product Description

Protein Description: MYC binding protein 2, E3 ubiquitin protein ligase
Gene Name: MYCBP2
Alternative Gene Name: FLJ10106, KIAA0916, PAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033004: 98%, ENSRNOG00000010479: 97%
Entrez Gene ID: 23077
Uniprot ID: O75592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL
• Gene Sequence: CYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEPESNMKSMPPSL
• Gene ID - Mouse: ENSMUSG00000033004
• Gene ID - Rat: ENSRNOG00000010479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti MYCBP2 pAb (ATL-HPA058807) – 1 Found

Yuan, Gongsheng; Yang, Shuting; Yang, Shuying. RGS12 represses oral squamous cell carcinoma by driving M1 polarization of tumor-associated macrophages via controlling ciliary MYCBP2/KIF2A signaling. International Journal Of Oral Science. 2023;15(1):11.